PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G22090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 313aa    MW: 33516.5 Da    PI: 8.3132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G22090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21.1e-191560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEde l ++v+++G ++W++I r+++ gR++k+c++rw + 
  OMERI06G22090.1 15 RGPWSPEEDEALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 60
                     89******************************.***********985 PP

2Myb_DNA-binding52.61e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r ++T+eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w+
  OMERI06G22090.1  67 RRPFTAEEDATILRAHARLGNR-WAAIARLLQ-GRTDNAVKNHWN 109
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.7461065IPR017930Myb domain
SuperFamilySSF466893.74E-3112108IPR009057Homeodomain-like
SMARTSM007172.2E-171463IPR001005SANT/Myb domain
PfamPF002498.7E-191560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-261668IPR009057Homeodomain-like
CDDcd001672.85E-161759No hitNo description
SMARTSM007176.3E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1467109IPR001005SANT/Myb domain
PROSITE profilePS5129419.56367116IPR017930Myb domain
CDDcd001673.80E-1169109No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2269116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGGGGGVEAD CDRIRGPWSP EEDEALRRLV ERHGARNWTA IGREIPGRSG KSCRLRWCNQ  60
LSPQVERRPF TAEEDATILR AHARLGNRWA AIARLLQGRT DNAVKNHWNC SLKRKLAVAT  120
TTTTTGAAAA PGVIADAAEV VERPCKRFSP SPDSPSGSGS GSDRSDLSHG GGSGGFGQIF  180
RPVARTGAFE PVDCAMSRRQ EEDPFTSLSL SLPGTDQRFN HDSAHSHFQE LPSSPSPPPP  240
PPPAAAAAPT RQYPFTPEFA AAMQEMIRAE VHKYMASVGV RAGCGDAGGA DLHMPQLVEG  300
VMRAAAERVG RMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-38121164108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1058170.0AK105817.1 Oryza sativa Japonica Group cDNA clone:001-203-C12, full insert sequence.
GenBankAK1215640.0AK121564.1 Oryza sativa Japonica Group cDNA clone:J033034J16, full insert sequence.
GenBankAP0035730.0AP003573.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0523F01.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankCT8339180.0CT833918.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN042F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641187.11e-175PREDICTED: transcription factor MYB44
SwissprotQ9FDW16e-64MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0E0E4400.0A0A0E0E440_9ORYZ; Uncharacterized protein
STRINGBGIOSGA020819-PA1e-175(Oryza sativa Indica Group)
STRINGLOC_Os06g43090.11e-175(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-60myb domain protein r1